Lineage for d1a15b_ (1a15 B:)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 77416Fold d.9: IL8-like [54116] (2 superfamilies)
  4. 77417Superfamily d.9.1: Interleukin 8-like chemokines [54117] (1 family) (S)
  5. 77418Family d.9.1.1: Interleukin 8-like chemokines [54118] (20 proteins)
  6. 77562Protein Stromal cell-derived factor-1 (SDF-1) [54150] (1 species)
  7. 77563Species Human (Homo sapiens) [TaxId:9606] [54151] (4 PDB entries)
  8. 77567Domain d1a15b_: 1a15 B: [37452]

Details for d1a15b_

PDB Entry: 1a15 (more details), 2.2 Å

PDB Description: sdf-1alpha

SCOP Domain Sequences for d1a15b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a15b_ d.9.1.1 (B:) Stromal cell-derived factor-1 (SDF-1) {Human (Homo sapiens)}
rcpcrffeshvaranvkhlkilntpacalqivarlknnnrqvcidpklkwiqeylek

SCOP Domain Coordinates for d1a15b_:

Click to download the PDB-style file with coordinates for d1a15b_.
(The format of our PDB-style files is described here.)

Timeline for d1a15b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1a15a_