Lineage for d6paid_ (6pai D:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2951860Superfamily d.58.7: RNA-binding domain, RBD, aka RNA recognition motif (RRM) [54928] (6 families) (S)
  5. 2952471Family d.58.7.0: automated matches [191529] (1 protein)
    not a true family
  6. 2952472Protein automated matches [190896] (11 species)
    not a true protein
  7. 2952511Species Human (Homo sapiens) [TaxId:9606] [188315] (106 PDB entries)
  8. 2952615Domain d6paid_: 6pai D: [374512]
    automated match to d2erra1
    complexed with epe, o6m, zn

Details for d6paid_

PDB Entry: 6pai (more details), 2.9 Å

PDB Description: structure of the human ddb1-dda1-dcaf15 e3 ubiquitin ligase bound to rbm39 and sulfonamide e7820
PDB Compounds: (D:) RNA-binding protein 39

SCOPe Domain Sequences for d6paid_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6paid_ d.58.7.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gpmrlyvgslhfnitedmlrgifepfgriesiqlmmdsetgrskgygfitfsdsecakka
leqlngfelagrpmkvghvt

SCOPe Domain Coordinates for d6paid_:

Click to download the PDB-style file with coordinates for d6paid_.
(The format of our PDB-style files is described here.)

Timeline for d6paid_: