SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1qg7b_ (1qg7 B:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2156493Fold d.9: IL8-like [54116] (2 superfamilies)
    beta(3)-alpha
  4. 2156494Superfamily d.9.1: Interleukin 8-like chemokines [54117] (2 families) (S)
    form dimers with different dimerisation modes
  5. 2156495Family d.9.1.1: Interleukin 8-like chemokines [54118] (25 protein domains)
  6. 2156731Protein Stromal cell-derived factor-1 (SDF-1) [54150] (1 species)
  7. 2156732Species Human (Homo sapiens) [TaxId:9606] [54151] (20 PDB entries)
  8. 2156739Domain d1qg7b_: 1qg7 B: [37450]
    complexed with so4

Details for d1qg7b_

PDB Entry: 1qg7 (more details), 2 Å

PDB Description: stroma cell-derived factor-1alpha (sdf-1alpha)
PDB Compounds: (B:) stromal cell-derived factor 1 alpha

SCOPe Domain Sequences for d1qg7b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qg7b_ d.9.1.1 (B:) Stromal cell-derived factor-1 (SDF-1) {Human (Homo sapiens) [TaxId: 9606]}
pvslsyrcpcrffeshvaranvkhlkilntpncalqivarlknnnrqvcidpklkwiqey
lekaln

SCOPe Domain Coordinates for d1qg7b_:

Click to download the PDB-style file with coordinates for d1qg7b_.
(The format of our PDB-style files is described here.)

Timeline for d1qg7b_: