Lineage for d1tvxd_ (1tvx D:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 30036Fold d.9: IL8-like [54116] (2 superfamilies)
  4. 30037Superfamily d.9.1: Interleukin 8-like chemokines [54117] (1 family) (S)
  5. 30038Family d.9.1.1: Interleukin 8-like chemokines [54118] (19 proteins)
  6. 30136Protein Neutrophil-activating peptide-2 (NAP-2) [54148] (1 species)
  7. 30137Species Human (Homo sapiens) [TaxId:9606] [54149] (2 PDB entries)
  8. 30141Domain d1tvxd_: 1tvx D: [37444]

Details for d1tvxd_

PDB Entry: 1tvx (more details), 1.75 Å

PDB Description: neutrophil activating peptide-2 variant form m6l with five additional amino terminal residues (dsdly)

SCOP Domain Sequences for d1tvxd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tvxd_ d.9.1.1 (D:) Neutrophil-activating peptide-2 (NAP-2) {Human (Homo sapiens)}
dsdlyaelrclcikttsgihpkniqslevigkgthcnqveviatlkdgrkicldpdapri
kkivqkklagd

SCOP Domain Coordinates for d1tvxd_:

Click to download the PDB-style file with coordinates for d1tvxd_.
(The format of our PDB-style files is described here.)

Timeline for d1tvxd_: