Lineage for d1tvxd_ (1tvx D:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.9: IL8-like [54116] (2 superfamilies)
    beta(3)-alpha
  4. Superfamily d.9.1: Interleukin 8-like chemokines [54117] (2 families) (S)
    form dimers with different dimerisation modes
  5. Family d.9.1.1: Interleukin 8-like chemokines [54118] (25 proteins)
  6. Protein Platelet basic protein, PBP [54148] (1 species)
    synonym: Small inducible cytokine B7; Neutrophil-activating peptide-2 (NAP-2), Connective tissue activating peptide-III (CTAP-III)
  7. Species Human (Homo sapiens) [TaxId:9606] [54149] (3 PDB entries)
  8. Domain d1tvxd_: 1tvx D: [37444]

Details for d1tvxd_

PDB Entry: 1tvx (more details), 1.75 Å

PDB Description: neutrophil activating peptide-2 variant form m6l with five additional amino terminal residues (dsdly)
PDB Compounds: (D:) neutrophil activating peptide 2 variant

SCOPe Domain Sequences for d1tvxd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tvxd_ d.9.1.1 (D:) Platelet basic protein, PBP {Human (Homo sapiens) [TaxId: 9606]}
dsdlyaelrclcikttsgihpkniqslevigkgthcnqveviatlkdgrkicldpdapri
kkivqkklagd

SCOPe Domain Coordinates for d1tvxd_ are not available.

Timeline for d1tvxd_:

Domains from other chains:
(mouse over for more information)
d1tvxa_, d1tvxb_, d1tvxc_