SCOPe 2.07: Domain d1b2ta1: 1b2t A:1-76

Lineage for d1b2ta1 (1b2t A:1-76)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.9: IL8-like [54116] (2 superfamilies)
   beta(3)-alpha

4. Superfamily d.9.1: Interleukin 8-like chemokines [54117] (2 families)
   form dimers with different dimerisation modes

5. Family d.9.1.1: Interleukin 8-like chemokines [54118] (25 proteins)

6. Protein Chemokine domain of fractalkine [54146] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [54147] (2 PDB entries)

8. Domain d1b2ta1: 1b2t A:1-76 [37440]
   Other proteins in same PDB: d1b2ta2

Details for d1b2ta1

PDB Entry: 1b2t

PDB Description: solution structure of the cx3c chemokine domain of fractalkine

PDB Compounds: (A:) protein (fractalkine)

SCOPe Domain Sequences for d1b2ta1:

Sequence; same for both SEQRES and ATOM records:

>d1b2ta1 d.9.1.1 (A:1-76) Chemokine domain of fractalkine {Human (Homo sapiens) [TaxId: 9606]}
qhhgvtkcnitcskmtskipvallihyqqnqascgkraiiletrqhrlfcadpkeqwvkd
amqhldrqaaaltrng

Timeline for d1b2ta1:

• d1b2ta1 first appeared (with stable ids) in SCOP 1.55, called d1b2ta_
  
• d1b2ta1 appears in SCOPe 2.06
  
• d1b2ta1 appears in the current release, SCOPe 2.08