Class g: Small proteins [56992] (100 folds) |
Fold g.44: RING/U-box [57849] (1 superfamily) dimetal(zinc)-bound alpha+beta motif; structurally diverse |
Superfamily g.44.1: RING/U-box [57850] (7 families) |
Family g.44.1.5: Zf-UBP [161204] (4 proteins) Pfam PF02148 |
Protein Ubiquitin carboxyl-terminal hydrolase 5, UBP5 [161207] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [161208] (9 PDB entries) Uniprot P45974 169-285 |
Domain d6p9ga_: 6p9g A: [374331] automated match to d2g45a_ complexed with o4y, unx, zn |
PDB Entry: 6p9g (more details), 2.1 Å
SCOPe Domain Sequences for d6p9ga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6p9ga_ g.44.1.5 (A:) Ubiquitin carboxyl-terminal hydrolase 5, UBP5 {Human (Homo sapiens) [TaxId: 9606]} vrqvskhafslkqldnparippcgwkcskcdmrenlwlnltdgsilcgrryfdgsggnnh avehyretgyplavklgtitpdgadvysydeddmvldpslaehlshfgidmlkmqkt
Timeline for d6p9ga_: