SCOPe 2.07: Domain d6j4mh_: 6j4m H:

Lineage for d6j4mh_ (6j4m H:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (10 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.0: automated matches [191307] (1 protein)
   not a true family

6. Protein automated matches [190036] (58 species)
   not a true protein

7. Species Soybean (Glycine max) [TaxId:3847] [255741] (4 PDB entries)

8. Domain d6j4mh_: 6j4m H: [374322]
   automated match to d3a68r_
   complexed with mg

Details for d6j4mh_

PDB Entry: 6j4m, 2.6 Å

PDB Description: thermal treated soybean seed h-2 ferritin

PDB Compounds: (H:) Ferritin

SCOPe Domain Sequences for d6j4mh_:

Sequence, based on SEQRES records:

>d6j4mh_ a.25.1.0 (H:) automated matches {Soybean (Glycine max) [TaxId: 3847]}
vslarqnyaddsesaineqinveynvsyvyhalfayfdrdnialkglakffkesseeere
haeqlikyqnirggrvvlhpitsppsefehsekgdalyamelalslekltnekllhvhsv
adrnndpqladfieseflyeqvksikkiaeyvaqlrlvgkghgvwhfdqkllhd

Sequence, based on observed residues (ATOM records):

>d6j4mh_ a.25.1.0 (H:) automated matches {Soybean (Glycine max) [TaxId: 3847]}
vslarqnyaddsesaineqinveynvsyvyhalfayfdrdnialkglakffkesseeere
haeqlikyqnirggrvvlhpitsppgdalyamelalslekltnekllhvhsvadrnndpq
ladfieseflyeqvksikkiaeyvaqlrlvgkghgvwhfdqkllhd

Timeline for d6j4mh_:

• d6j4mh_ is new in SCOPe 2.07-stable
  
• d6j4mh_ appears in the current release, SCOPe 2.08