Lineage for d6j4mh_ (6j4m H:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2700837Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2700838Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2703895Family a.25.1.0: automated matches [191307] (1 protein)
    not a true family
  6. 2703896Protein automated matches [190036] (60 species)
    not a true protein
  7. 2705060Species Soybean (Glycine max) [TaxId:3847] [255741] (4 PDB entries)
  8. 2705116Domain d6j4mh_: 6j4m H: [374322]
    automated match to d3a68r_
    complexed with mg

Details for d6j4mh_

PDB Entry: 6j4m (more details), 2.6 Å

PDB Description: thermal treated soybean seed h-2 ferritin
PDB Compounds: (H:) Ferritin

SCOPe Domain Sequences for d6j4mh_:

Sequence, based on SEQRES records: (download)

>d6j4mh_ a.25.1.0 (H:) automated matches {Soybean (Glycine max) [TaxId: 3847]}
vslarqnyaddsesaineqinveynvsyvyhalfayfdrdnialkglakffkesseeere
haeqlikyqnirggrvvlhpitsppsefehsekgdalyamelalslekltnekllhvhsv
adrnndpqladfieseflyeqvksikkiaeyvaqlrlvgkghgvwhfdqkllhd

Sequence, based on observed residues (ATOM records): (download)

>d6j4mh_ a.25.1.0 (H:) automated matches {Soybean (Glycine max) [TaxId: 3847]}
vslarqnyaddsesaineqinveynvsyvyhalfayfdrdnialkglakffkesseeere
haeqlikyqnirggrvvlhpitsppgdalyamelalslekltnekllhvhsvadrnndpq
ladfieseflyeqvksikkiaeyvaqlrlvgkghgvwhfdqkllhd

SCOPe Domain Coordinates for d6j4mh_:

Click to download the PDB-style file with coordinates for d6j4mh_.
(The format of our PDB-style files is described here.)

Timeline for d6j4mh_: