Lineage for d1eiga_ (1eig A:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.9: IL8-like [54116] (2 superfamilies)
    beta(3)-alpha
  4. Superfamily d.9.1: Interleukin 8-like chemokines [54117] (2 families) (S)
    form dimers with different dimerisation modes
  5. Family d.9.1.1: Interleukin 8-like chemokines [54118] (25 proteins)
  6. Protein Eotaxin-2 [54142] (1 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [54143] (2 PDB entries)
  8. Domain d1eiga_: 1eig A: [37432]

Details for d1eiga_

PDB Entry: 1eig (more details)

PDB Description: solution structure of the human chemokine eotaxin-2
PDB Compounds: (A:) eotaxin-2

SCOPe Domain Sequences for d1eiga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eiga_ d.9.1.1 (A:) Eotaxin-2 {Human (Homo sapiens) [TaxId: 9606]}
vvipspccmffvskripenrvvsyqlssrstclkagvifttkkgqqscgdpkqewvqrym
knldakqkkaspr

SCOPe Domain Coordinates for d1eiga_ are not available.

Timeline for d1eiga_: