Lineage for d1eiha_ (1eih A:)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 324905Fold d.9: IL8-like [54116] (1 superfamily)
    beta(3)-alpha
  4. 324906Superfamily d.9.1: Interleukin 8-like chemokines [54117] (1 family) (S)
    form dimers with different dimerisation modes
  5. 324907Family d.9.1.1: Interleukin 8-like chemokines [54118] (22 proteins)
  6. 324925Protein Eotaxin-2 [54142] (1 species)
  7. 324926Species Human (Homo sapiens) [TaxId:9606] [54143] (2 PDB entries)
  8. 324927Domain d1eiha_: 1eih A: [37431]

Details for d1eiha_

PDB Entry: 1eih (more details)

PDB Description: solution structure of the human chemokine eotaxin-2

SCOP Domain Sequences for d1eiha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eiha_ d.9.1.1 (A:) Eotaxin-2 {Human (Homo sapiens)}
vvipspccmffvskripenrvvsyqlssrstclkagvifttkkgqqscgdpkqewvqrym
knldakqkkaspr

SCOP Domain Coordinates for d1eiha_:

Click to download the PDB-style file with coordinates for d1eiha_.
(The format of our PDB-style files is described here.)

Timeline for d1eiha_: