SCOP 1.61: Domain d1eiha_: 1eih A:

Lineage for d1eiha_ (1eih A:)

1. Root: SCOP 1.61

2. Class d: Alpha and beta proteins (a+b) [53931] (212 folds)

3. Fold d.9: IL8-like [54116] (2 superfamilies)

4. Superfamily d.9.1: Interleukin 8-like chemokines [54117] (1 family)

5. Family d.9.1.1: Interleukin 8-like chemokines [54118] (22 proteins)

6. Protein Eotaxin-2 [54142] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [54143] (2 PDB entries)

8. Domain d1eiha_: 1eih A: [37431]

Details for d1eiha_

PDB Entry: 1eih

PDB Description: solution structure of the human chemokine eotaxin-2

SCOP Domain Sequences for d1eiha_:

Sequence; same for both SEQRES and ATOM records:

>d1eiha_ d.9.1.1 (A:) Eotaxin-2 {Human (Homo sapiens)}
vvipspccmffvskripenrvvsyqlssrstclkagvifttkkgqqscgdpkqewvqrym
knldakqkkaspr

Timeline for d1eiha_:

• d1eiha_ first appeared (with stable ids) in SCOP 1.55
  
• d1eiha_ appears in SCOP 1.59
  
• d1eiha_ appears in SCOP 1.63
  
• d1eiha_ appears in the current release, SCOPe 2.08