![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.66: 4-bladed beta-propeller [50922] (1 superfamily) consists of four 4-stranded beta-sheet motifs; meander |
![]() | Superfamily b.66.1: Hemopexin-like domain [50923] (2 families) ![]() |
![]() | Family b.66.1.0: automated matches [196610] (1 protein) not a true family |
![]() | Protein automated matches [196611] (2 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [196612] (9 PDB entries) |
![]() | Domain d6o5ea_: 6o5e A: [374277] automated match to d3c7xa_ complexed with cl, imd, na, no3, so4 |
PDB Entry: 6o5e (more details), 1.9 Å
SCOPe Domain Sequences for d6o5ea_:
Sequence, based on SEQRES records: (download)
>d6o5ea_ b.66.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} melcsgkpfdaftdlkngslfafrgqysyeldekavrpgypklirdvwgiegpidaaftr insqgktylfkgsqywrfedgvldpdyprnisdgfdgipdnvdaalalpahsysgrervy ffkgkqyweyqfqrtsagtrqpqfisrdwhgvpgqvdaamagrisvfffsgdkyyrvnlr trrvdtvdppyprsiaqywlgcpa
>d6o5ea_ b.66.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} melcsgkpfdaftdlkngslfafrgqysyeldekavrpgypklirdvwgiegpidaaftr insqgktylfkgsqywrfedgvldpdyprnisdgfdgipdnvdaalalpervyffkgkqy weyqfqpqfisrdwhgvpgqvdaamagrisvfffsgdkyyrvnlrtrrvdtvdppyprsi aqywlgcpa
Timeline for d6o5ea_: