Lineage for d6ntfa2 (6ntf A:332-501)

  1. Root: SCOPe 2.07
  2. 2590057Class h: Coiled coil proteins [57942] (7 folds)
  3. 2591558Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 2591559Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 2592334Family h.3.1.0: automated matches [254278] (1 protein)
    not a true family
  6. 2592335Protein automated matches [254645] (35 species)
    not a true protein
  7. 2592469Species Unidentified influenza virus [TaxId:11309] [315420] (5 PDB entries)
  8. 3074207Domain d6ntfa2: 6ntf A:332-501 [374269]
    Other proteins in same PDB: d6ntfa1
    automated match to d1ha0a2
    complexed with mg, nag, peg

Details for d6ntfa2

PDB Entry: 6ntf (more details), 2.8 Å

PDB Description: crystal structure of a computationally optimized h5 influenza hemagglutinin
PDB Compounds: (A:) Hemagglutinin

SCOPe Domain Sequences for d6ntfa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ntfa2 h.3.1.0 (A:332-501) automated matches {Unidentified influenza virus [TaxId: 11309]}
lfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmnt
qfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlydk
vrlqlrdnakelgngcfefyhkcdnecmesvrngtydypqyseearlkre

SCOPe Domain Coordinates for d6ntfa2:

Click to download the PDB-style file with coordinates for d6ntfa2.
(The format of our PDB-style files is described here.)

Timeline for d6ntfa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d6ntfa1