Lineage for d6ntfa2 (6ntf A:332-501)
- Root: SCOPe 2.08
Class h: Coiled coil proteins [57942] (7 folds) 
Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
core: trimeric coiled coil
Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) 
Family h.3.1.0: automated matches [254278] (1 protein)
not a true familyProtein automated matches [254645] (42 species)
not a true protein
Species Unidentified influenza virus [TaxId:11309] [315420] (5 PDB entries) 
Domain d6ntfa2: 6ntf A:332-501 [374269]
Other proteins in same PDB: d6ntfa1
automated match to d1ha0a2
complexed with mg, nag, peg
Details for d6ntfa2
PDB Entry: 6ntf (more details), 2.8 Å
PDB Description: crystal structure of a computationally optimized h5 influenza hemagglutinin
PDB Compounds: (A:) HemagglutininSCOPe Domain Sequences for d6ntfa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6ntfa2 h.3.1.0 (A:332-501) automated matches {Unidentified influenza virus [TaxId: 11309]}
lfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmnt
qfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlydk
vrlqlrdnakelgngcfefyhkcdnecmesvrngtydypqyseearlkre
SCOPe Domain Coordinates for d6ntfa2:
Click to download the PDB-style file with coordinates for d6ntfa2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d6ntfa2:
- d6ntfa2 first appeared in SCOPe 2.07
View in 3D
