Lineage for d6ntfa1 (6ntf A:1-321)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2370814Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2370815Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2371474Family b.19.1.0: automated matches [227246] (1 protein)
    not a true family
  6. 2371475Protein automated matches [227017] (47 species)
    not a true protein
  7. 2371786Species Unidentified influenza virus [TaxId:11309] [225763] (9 PDB entries)
  8. 3074206Domain d6ntfa1: 6ntf A:1-321 [374268]
    Other proteins in same PDB: d6ntfa2
    automated match to d4we4a_
    complexed with mg, nag, peg

Details for d6ntfa1

PDB Entry: 6ntf (more details), 2.8 Å

PDB Description: crystal structure of a computationally optimized h5 influenza hemagglutinin
PDB Compounds: (A:) Hemagglutinin

SCOPe Domain Sequences for d6ntfa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ntfa1 b.19.1.0 (A:1-321) automated matches {Unidentified influenza virus [TaxId: 11309]}
dqicigyhannsteqvdtimeknvtvthaqdilekthngklcdldgvkplilrdcsvagw
llgnpmcdefinvpewsyivekanpandlcfpgnfndyeelkhllsrinhfekiqiipks
swsdheassgvssacpyqgspsffrnvvwlikknntyptikrsynntnqedllvlwgihh
pndaaeqtrlyqnpttyisvgtstlnqrlvpkiatrskvngqsgrmeffwtilkpndain
fesngnfiapeyaykivkkgdsaimkseleygncntkcqtpigainssmpfhnihpltig
ecpkyvksnrlvlatglrnsp

SCOPe Domain Coordinates for d6ntfa1:

Click to download the PDB-style file with coordinates for d6ntfa1.
(The format of our PDB-style files is described here.)

Timeline for d6ntfa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6ntfa2