Lineage for d6o5eb_ (6o5e B:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2416783Fold b.66: 4-bladed beta-propeller [50922] (1 superfamily)
    consists of four 4-stranded beta-sheet motifs; meander
  4. 2416784Superfamily b.66.1: Hemopexin-like domain [50923] (2 families) (S)
  5. 2416819Family b.66.1.0: automated matches [196610] (1 protein)
    not a true family
  6. 2416820Protein automated matches [196611] (2 species)
    not a true protein
  7. 2416821Species Human (Homo sapiens) [TaxId:9606] [196612] (9 PDB entries)
  8. 2416824Domain d6o5eb_: 6o5e B: [374263]
    automated match to d3c7xa_
    complexed with cl, imd, na, no3, so4

Details for d6o5eb_

PDB Entry: 6o5e (more details), 1.9 Å

PDB Description: crystal structure of the vitronectin hemopexin-like domain
PDB Compounds: (B:) Vitronectin

SCOPe Domain Sequences for d6o5eb_:

Sequence, based on SEQRES records: (download)

>d6o5eb_ b.66.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
elcsgkpfdaftdlkngslfafrgqysyeldekavrpgypklirdvwgiegpidaaftri
nsqgktylfkgsqywrfedgvldpdyprnisdgfdgipdnvdaalalpahsysgrervyf
fkgkqyweyqfqrtsagtrqpqfisrdwhgvpgqvdaamagrisvfffsgdkyyrvnlrt
rrvdtvdppyprsiaqywlgcpa

Sequence, based on observed residues (ATOM records): (download)

>d6o5eb_ b.66.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
elcsgkpfdaftdlkngslfafrgqysyeldpklirdvwgiegpidaaftrigktylfkg
sqywrfedgvldpdyprnisdgfdgipdnvdaalalpervyffkgkqyweyqfqpqfisr
dwhgvpgqvdaamagrisvfffsgdkyyrvnlrtrrvdtvdppyprsiaqywlgcpa

SCOPe Domain Coordinates for d6o5eb_:

Click to download the PDB-style file with coordinates for d6o5eb_.
(The format of our PDB-style files is described here.)

Timeline for d6o5eb_: