Lineage for d6ntba_ (6ntb A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2555938Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2557428Superfamily d.58.5: GlnB-like [54913] (6 families) (S)
    form timeric structures with the orthogonally packed beta-sheets
  5. 2557730Family d.58.5.0: automated matches [191474] (1 protein)
    not a true family
  6. 2557731Protein automated matches [190753] (21 species)
    not a true protein
  7. 2557811Species Cyanobium sp. [TaxId:180281] [374194] (6 PDB entries)
  8. 2557820Domain d6ntba_: 6ntb A: [374261]
    Other proteins in same PDB: d6ntbc2
    automated match to d3dfeb_
    complexed with atp, cl

Details for d6ntba_

PDB Entry: 6ntb (more details), 1.9 Å

PDB Description: pii-like sbtb from cyanobium sp pcc 7001 bound to atp
PDB Compounds: (A:) SbtB7001, PII-like protein

SCOPe Domain Sequences for d6ntba_:

Sequence, based on SEQRES records: (download)

>d6ntba_ d.58.5.0 (A:) automated matches {Cyanobium sp. [TaxId: 180281]}
sqqvwklviiteeillkkvskiikeagasgytvlaaagegsrnvrstgepsvshaysnik
fevltasreladqiqdkvvakyfddyscityistvealrahkf

Sequence, based on observed residues (ATOM records): (download)

>d6ntba_ d.58.5.0 (A:) automated matches {Cyanobium sp. [TaxId: 180281]}
sqqvwklviiteeillkkvskiikeagasgytvlaaagegsrnvrstgsnikfevltasr
eladqiqdkvvakyfddyscityistvealrahkf

SCOPe Domain Coordinates for d6ntba_:

Click to download the PDB-style file with coordinates for d6ntba_.
(The format of our PDB-style files is described here.)

Timeline for d6ntba_: