| Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
| Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.5: GlnB-like [54913] (6 families) ![]() form timeric structures with the orthogonally packed beta-sheets |
| Family d.58.5.0: automated matches [191474] (1 protein) not a true family |
| Protein automated matches [190753] (21 species) not a true protein |
| Species Cyanobium sp. [TaxId:180281] [374194] (6 PDB entries) |
| Domain d6ntba_: 6ntb A: [374261] Other proteins in same PDB: d6ntbc2 automated match to d3dfeb_ complexed with atp, cl |
PDB Entry: 6ntb (more details), 1.9 Å
SCOPe Domain Sequences for d6ntba_:
Sequence, based on SEQRES records: (download)
>d6ntba_ d.58.5.0 (A:) automated matches {Cyanobium sp. [TaxId: 180281]}
sqqvwklviiteeillkkvskiikeagasgytvlaaagegsrnvrstgepsvshaysnik
fevltasreladqiqdkvvakyfddyscityistvealrahkf
>d6ntba_ d.58.5.0 (A:) automated matches {Cyanobium sp. [TaxId: 180281]}
sqqvwklviiteeillkkvskiikeagasgytvlaaagegsrnvrstgsnikfevltasr
eladqiqdkvvakyfddyscityistvealrahkf
Timeline for d6ntba_: