Lineage for d6j33b2 (6j33 B:163-287)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2375023Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2376005Family b.1.18.0: automated matches [191341] (1 protein)
    not a true family
  6. 2376006Protein automated matches [190226] (72 species)
    not a true protein
  7. 2376208Species Klebsiella pneumoniae [TaxId:573] [359373] (10 PDB entries)
  8. 2376211Domain d6j33b2: 6j33 B:163-287 [374255]
    Other proteins in same PDB: d6j33a1, d6j33a4, d6j33a5, d6j33b1, d6j33b4, d6j33b5
    automated match to d2fhfa2
    complexed with act, ca, mg

Details for d6j33b2

PDB Entry: 6j33 (more details), 1.3 Å

PDB Description: crystal structure of ligand-free of pula from klebsiella pneumoniae
PDB Compounds: (B:) pullulanase

SCOPe Domain Sequences for d6j33b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6j33b2 b.1.18.0 (B:163-287) automated matches {Klebsiella pneumoniae [TaxId: 573]}
sradafraafgvaladahwvdkttllwpggenkpivrlyyshsskvaadsngefsdkyvk
ltpttvsqqvsmrfphlasypafklpddvnvdellqgetvaiaaesdgilssatqvqtag
vlddt

SCOPe Domain Coordinates for d6j33b2:

Click to download the PDB-style file with coordinates for d6j33b2.
(The format of our PDB-style files is described here.)

Timeline for d6j33b2: