Class b: All beta proteins [48724] (180 folds) |
Fold b.3: Prealbumin-like [49451] (8 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands to common fold |
Superfamily b.3.1: Starch-binding domain-like [49452] (4 families) |
Family b.3.1.0: automated matches [254199] (1 protein) not a true family |
Protein automated matches [254436] (5 species) not a true protein |
Species Klebsiella pneumoniae [TaxId:573] [359371] (9 PDB entries) |
Domain d6j33b1: 6j33 B:31-162 [374254] Other proteins in same PDB: d6j33a2, d6j33a3, d6j33a4, d6j33a5, d6j33b2, d6j33b3, d6j33b4, d6j33b5 automated match to d2fhfa3 complexed with act, ca, mg |
PDB Entry: 6j33 (more details), 1.3 Å
SCOPe Domain Sequences for d6j33b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6j33b1 b.3.1.0 (B:31-162) automated matches {Klebsiella pneumoniae [TaxId: 573]} mdvvvrlpdvavpgeavqasarqavihlvdiagitsstpadyatknlylwnnetcdalsa pvadwndvsttptgsdkygpywvipltkesgcinvivrdgtnklidsdlrvsfsdftdrt vsviagnsavyd
Timeline for d6j33b1: