Lineage for d6j33b1 (6j33 B:31-162)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2768597Fold b.3: Prealbumin-like [49451] (8 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 2768598Superfamily b.3.1: Starch-binding domain-like [49452] (4 families) (S)
  5. 2768737Family b.3.1.0: automated matches [254199] (1 protein)
    not a true family
  6. 2768738Protein automated matches [254436] (5 species)
    not a true protein
  7. 2768748Species Klebsiella pneumoniae [TaxId:573] [359371] (9 PDB entries)
  8. 2768750Domain d6j33b1: 6j33 B:31-162 [374254]
    Other proteins in same PDB: d6j33a2, d6j33a3, d6j33a4, d6j33a5, d6j33b2, d6j33b3, d6j33b4, d6j33b5
    automated match to d2fhfa3
    complexed with act, ca, mg

Details for d6j33b1

PDB Entry: 6j33 (more details), 1.3 Å

PDB Description: crystal structure of ligand-free of pula from klebsiella pneumoniae
PDB Compounds: (B:) pullulanase

SCOPe Domain Sequences for d6j33b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6j33b1 b.3.1.0 (B:31-162) automated matches {Klebsiella pneumoniae [TaxId: 573]}
mdvvvrlpdvavpgeavqasarqavihlvdiagitsstpadyatknlylwnnetcdalsa
pvadwndvsttptgsdkygpywvipltkesgcinvivrdgtnklidsdlrvsfsdftdrt
vsviagnsavyd

SCOPe Domain Coordinates for d6j33b1:

Click to download the PDB-style file with coordinates for d6j33b1.
(The format of our PDB-style files is described here.)

Timeline for d6j33b1: