SCOPe 2.07: Domain d6ntbb_: 6ntb B:

Lineage for d6ntbb_ (6ntb B:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.5: GlnB-like [54913] (6 families)
   form timeric structures with the orthogonally packed beta-sheets

5. Family d.58.5.0: automated matches [191474] (1 protein)
   not a true family

6. Protein automated matches [190753] (21 species)
   not a true protein

7. Species Cyanobium sp. [TaxId:180281] [374194] (6 PDB entries)

8. Domain d6ntbb_: 6ntb B: [374249]
   Other proteins in same PDB: d6ntbc2
   automated match to d3dfeb_
   complexed with atp, cl

Details for d6ntbb_

PDB Entry: 6ntb, 1.9 Å

PDB Description: pii-like sbtb from cyanobium sp pcc 7001 bound to atp

PDB Compounds: (B:) SbtB7001, PII-like protein

SCOPe Domain Sequences for d6ntbb_:

Sequence, based on SEQRES records:

>d6ntbb_ d.58.5.0 (B:) automated matches {Cyanobium sp. [TaxId: 180281]}
sqqvwklviiteeillkkvskiikeagasgytvlaaagegsrnvrstgepsvshaysnik
fevltasreladqiqdkvvakyfddyscityistvealrahkf

Sequence, based on observed residues (ATOM records):

>d6ntbb_ d.58.5.0 (B:) automated matches {Cyanobium sp. [TaxId: 180281]}
sqqvwklviiteeillkkvskiikeagasgytvlaaagegsrnvrstshaysnikfevlt
asreladqiqdkvvakyfddyscityistvealrahkf

Timeline for d6ntbb_:

• d6ntbb_ is new in SCOPe 2.07-stable
  
• d6ntbb_ appears in the current release, SCOPe 2.08