Lineage for d6j7uc_ (6j7u C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2845793Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2845794Protein automated matches [190069] (319 species)
    not a true protein
  7. 2849233Species Uncultured bacterium [TaxId:77133] [374149] (2 PDB entries)
  8. 2849240Domain d6j7uc_: 6j7u C: [374237]
    automated match to d5ojia_
    complexed with ndp

Details for d6j7uc_

PDB Entry: 6j7u (more details), 2.3 Å

PDB Description: crystal structure of blue fluorescent protein from metagenomic library in complex with nadph
PDB Compounds: (C:) blue fluorescent protein

SCOPe Domain Sequences for d6j7uc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6j7uc_ c.2.1.0 (C:) automated matches {Uncultured bacterium [TaxId: 77133]}
qnlngkvafvtggsrgigaaivrrlaadgadiaftyvsassknvatalvqeleakgrrar
aiqadsadpaqvrqaveqaivqlgpvdvlvnnagiflagplgevtlddyertmninvrap
fvaiqaaqasmpdggriinigsclaeragragvtlyaasksallgmtrglardlgargit
anvvhpgpidtdmnpadgersgelvavlslphygevrdiagmvaflagpdgryvtgasla
vdggfaa

SCOPe Domain Coordinates for d6j7uc_:

Click to download the PDB-style file with coordinates for d6j7uc_.
(The format of our PDB-style files is described here.)

Timeline for d6j7uc_: