SCOPe 2.07: Domain d6mmoa1: 6mmo A:1-103

Lineage for d6mmoa1 (6mmo A:1-103)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.5: GlnB-like [54913] (6 families)
   form timeric structures with the orthogonally packed beta-sheets

5. Family d.58.5.0: automated matches [191474] (1 protein)
   not a true family

6. Protein automated matches [190753] (21 species)
   not a true protein

7. Species Cyanobium sp. [TaxId:180281] [374194] (6 PDB entries)

8. Domain d6mmoa1: 6mmo A:1-103 [374222]
   Other proteins in same PDB: d6mmoa2, d6mmoe2
   automated match to d3dfeb_
   complexed with amp, cl, mg

Details for d6mmoa1

PDB Entry: 6mmo, 1.86 Å

PDB Description: carbon regulatory pii-like protein sbtb from cyanobium sp. 7001 bound to amp

PDB Compounds: (A:) Carbon regulatory PII-like protein SbtB

SCOPe Domain Sequences for d6mmoa1:

Sequence, based on SEQRES records:

>d6mmoa1 d.58.5.0 (A:1-103) automated matches {Cyanobium sp. [TaxId: 180281]}
sqqvwklviiteeillkkvskiikeagasgytvlaaagegsrnvrstgepsvshaysnik
fevltasreladqiqdkvvakyfddyscityistvealrahkf

Sequence, based on observed residues (ATOM records):

>d6mmoa1 d.58.5.0 (A:1-103) automated matches {Cyanobium sp. [TaxId: 180281]}
sqqvwklviiteeillkkvskiikeagasgytvlaaagegsaysnikfevltasreladq
iqdkvvakyfddyscityistvealrahkf

Timeline for d6mmoa1:

• d6mmoa1 is new in SCOPe 2.07-stable
  
• d6mmoa1 appears in the current release, SCOPe 2.08