![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
![]() | Superfamily b.6.1: Cupredoxins [49503] (8 families) ![]() contains copper-binding site |
![]() | Family b.6.1.2: Periplasmic domain of cytochrome c oxidase subunit II [49541] (3 proteins) |
![]() | Protein Cytochrome c oxidase [49544] (4 species) |
![]() | Species Cow (Bos taurus) [TaxId:9913] [49545] (45 PDB entries) |
![]() | Domain d6jy4b2: 6jy4 B:91-227 [374221] Other proteins in same PDB: d6jy4a_, d6jy4b1, d6jy4c_, d6jy4d_, d6jy4e_, d6jy4f_, d6jy4g_, d6jy4h_, d6jy4i_, d6jy4j_, d6jy4k_, d6jy4l_, d6jy4m_ automated match to d1v54b1 complexed with cdl, chd, cqx, cu, cua, hea, mg, na, pek, pgv, zn |
PDB Entry: 6jy4 (more details), 1.95 Å
SCOPe Domain Sequences for d6jy4b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6jy4b2 b.6.1.2 (B:91-227) Cytochrome c oxidase {Cow (Bos taurus) [TaxId: 9913]} nnpsltvktmghqwywsyeytdyedlsfdsymiptselkpgelrllevdnrvvlpmemti rmlvssedvlhswavpslglktdaipgrlnqttlmssrpglyygqcseicgsnhsfmpiv lelvplkyfekwsasml
Timeline for d6jy4b2: