SCOPe 2.07: Domain d6jy4b1: 6jy4 B:1-90

Lineage for d6jy4b1 (6jy4 B:1-90)

1. Root: SCOPe 2.07

2. Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)

3. Fold f.17: Transmembrane helix hairpin [81334] (6 superfamilies)
   two antiparallel transmembrane helices

4. Superfamily f.17.2: Cytochrome c oxidase subunit II-like, transmembrane region [81464] (2 families)

5. Family f.17.2.1: Cytochrome c oxidase subunit II-like, transmembrane region [81463] (5 proteins)

6. Protein Mitochondrial cytochrome c oxidase, subunit II [81455] (1 species)

7. Species Cow (Bos taurus) [TaxId:9913] [81454] (45 PDB entries)

8. Domain d6jy4b1: 6jy4 B:1-90 [374220]
   Other proteins in same PDB: d6jy4a_, d6jy4b2, d6jy4c_, d6jy4d_, d6jy4e_, d6jy4f_, d6jy4g_, d6jy4h_, d6jy4i_, d6jy4j_, d6jy4k_, d6jy4l_, d6jy4m_
   automated match to d1v54b2
   complexed with cdl, chd, cqx, cu, cua, hea, mg, na, pek, pgv, zn

Details for d6jy4b1

PDB Entry: 6jy4, 1.95 Å

PDB Description: monomeric form of bovine heart cytochrome c oxidase in the fully reduced state

PDB Compounds: (B:) Cytochrome c oxidase subunit 2

SCOPe Domain Sequences for d6jy4b1:

Sequence; same for both SEQRES and ATOM records:

>d6jy4b1 f.17.2.1 (B:1-90) Mitochondrial cytochrome c oxidase, subunit II {Cow (Bos taurus) [TaxId: 9913]}
maypmqlgfqdatspimeellhfhdhtlmivflisslvlyiislmlttklthtstmdaqe
vetiwtilpaiililialpslrilymmdei

Timeline for d6jy4b1:

• d6jy4b1 is new in SCOPe 2.07-stable
  
• d6jy4b1 appears in the current release, SCOPe 2.08