Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
Fold f.17: Transmembrane helix hairpin [81334] (6 superfamilies) two antiparallel transmembrane helices |
Superfamily f.17.2: Cytochrome c oxidase subunit II-like, transmembrane region [81464] (2 families) |
Family f.17.2.1: Cytochrome c oxidase subunit II-like, transmembrane region [81463] (5 proteins) |
Protein Mitochondrial cytochrome c oxidase, subunit II [81455] (1 species) |
Species Cow (Bos taurus) [TaxId:9913] [81454] (45 PDB entries) |
Domain d6jy4b1: 6jy4 B:1-90 [374220] Other proteins in same PDB: d6jy4a_, d6jy4b2, d6jy4c_, d6jy4d_, d6jy4e_, d6jy4f_, d6jy4g_, d6jy4h_, d6jy4i_, d6jy4j_, d6jy4k_, d6jy4l_, d6jy4m_ automated match to d1v54b2 complexed with cdl, chd, cqx, cu, cua, hea, mg, na, pek, pgv, zn |
PDB Entry: 6jy4 (more details), 1.95 Å
SCOPe Domain Sequences for d6jy4b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6jy4b1 f.17.2.1 (B:1-90) Mitochondrial cytochrome c oxidase, subunit II {Cow (Bos taurus) [TaxId: 9913]} maypmqlgfqdatspimeellhfhdhtlmivflisslvlyiislmlttklthtstmdaqe vetiwtilpaiililialpslrilymmdei
Timeline for d6jy4b1: