Lineage for d6n4af_ (6n4a F:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2555938Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2557428Superfamily d.58.5: GlnB-like [54913] (6 families) (S)
    form timeric structures with the orthogonally packed beta-sheets
  5. 2557730Family d.58.5.0: automated matches [191474] (1 protein)
    not a true family
  6. 2557731Protein automated matches [190753] (21 species)
    not a true protein
  7. 2557811Species Cyanobium sp. [TaxId:180281] [374194] (6 PDB entries)
  8. 2557834Domain d6n4af_: 6n4a F: [374215]
    automated match to d3dfeb_
    complexed with po4

Details for d6n4af_

PDB Entry: 6n4a (more details), 2.3 Å

PDB Description: pii-like sbtb from cyanobium sp pcc 7001 (apo)
PDB Compounds: (F:) PII-like SbtB

SCOPe Domain Sequences for d6n4af_:

Sequence, based on SEQRES records: (download)

>d6n4af_ d.58.5.0 (F:) automated matches {Cyanobium sp. [TaxId: 180281]}
qqvwklviiteeillkkvskiikeagasgytvlaaagegsrnvrstgepsvshaysnikf
evltasreladqiqdkvvakyfddyscityistvealrah

Sequence, based on observed residues (ATOM records): (download)

>d6n4af_ d.58.5.0 (F:) automated matches {Cyanobium sp. [TaxId: 180281]}
qqvwklviiteeillkkvskiikeagasgytvlaaageaysnikfevltasreladqiqd
kvvakyfddyscityistvealrah

SCOPe Domain Coordinates for d6n4af_:

Click to download the PDB-style file with coordinates for d6n4af_.
(The format of our PDB-style files is described here.)

Timeline for d6n4af_: