SCOPe 2.07: Domain d6mmqb1: 6mmq B:2-104

Lineage for d6mmqb1 (6mmq B:2-104)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.5: GlnB-like [54913] (6 families)
   form timeric structures with the orthogonally packed beta-sheets

5. Family d.58.5.0: automated matches [191474] (1 protein)
   not a true family

6. Protein automated matches [190753] (21 species)
   not a true protein

7. Species Cyanobium sp. [TaxId:180281] [374194] (6 PDB entries)

8. Domain d6mmqb1: 6mmq B:2-104 [374211]
   Other proteins in same PDB: d6mmqb2
   automated match to d3dfeb_
   complexed with cmp

Details for d6mmqb1

PDB Entry: 6mmq, 2.02 Å

PDB Description: carbon regulatory pii-like protein sbtb from cyanobium sp. 7001 bound to camp

PDB Compounds: (B:) Carbon regulatory PII-like protein SbtB

SCOPe Domain Sequences for d6mmqb1:

Sequence, based on SEQRES records:

>d6mmqb1 d.58.5.0 (B:2-104) automated matches {Cyanobium sp. [TaxId: 180281]}
sqqvwklviiteeillkkvskiikeagasgytvlaaagegsrnvrstgepsvshaysnik
fevltasreladqiqdkvvakyfddyscityistvealrahkf

Sequence, based on observed residues (ATOM records):

>d6mmqb1 d.58.5.0 (B:2-104) automated matches {Cyanobium sp. [TaxId: 180281]}
sqqvwklviiteeillkkvskiikeagasgytvlaaagegaysnikfevltasreladqi
qdkvvakyfddyscityistvealrahkf

Timeline for d6mmqb1:

• d6mmqb1 is new in SCOPe 2.07-stable
  
• d6mmqb1 appears in the current release, SCOPe 2.08