SCOPe 2.07: Domain d6jy3b1: 6jy3 B:1-90

Lineage for d6jy3b1 (6jy3 B:1-90)

1. Root: SCOPe 2.07

2. Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)

3. Fold f.17: Transmembrane helix hairpin [81334] (6 superfamilies)
   two antiparallel transmembrane helices

4. Superfamily f.17.2: Cytochrome c oxidase subunit II-like, transmembrane region [81464] (2 families)

5. Family f.17.2.1: Cytochrome c oxidase subunit II-like, transmembrane region [81463] (5 proteins)

6. Protein Mitochondrial cytochrome c oxidase, subunit II [81455] (1 species)

7. Species Cow (Bos taurus) [TaxId:9913] [81454] (45 PDB entries)

8. Domain d6jy3b1: 6jy3 B:1-90 [374198]
   Other proteins in same PDB: d6jy3a_, d6jy3b2, d6jy3c_, d6jy3d_, d6jy3e_, d6jy3f_, d6jy3g_, d6jy3h_, d6jy3i_, d6jy3j_, d6jy3k_, d6jy3l_, d6jy3m_
   automated match to d1v54b2
   complexed with cdl, chd, cqx, cu, cua, hea, mg, na, pek, per, pgv, zn

Details for d6jy3b1

PDB Entry: 6jy3, 1.85 Å

PDB Description: monomeric form of bovine heart cytochrome c oxidase in the fully oxidized state

PDB Compounds: (B:) Cytochrome c oxidase subunit 2

SCOPe Domain Sequences for d6jy3b1:

Sequence; same for both SEQRES and ATOM records:

>d6jy3b1 f.17.2.1 (B:1-90) Mitochondrial cytochrome c oxidase, subunit II {Cow (Bos taurus) [TaxId: 9913]}
maypmqlgfqdatspimeellhfhdhtlmivflisslvlyiislmlttklthtstmdaqe
vetiwtilpaiililialpslrilymmdei

Timeline for d6jy3b1:

• d6jy3b1 is new in SCOPe 2.07-stable
  
• d6jy3b1 appears in the current release, SCOPe 2.08