Lineage for d6mmqc_ (6mmq C:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2555938Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2557428Superfamily d.58.5: GlnB-like [54913] (6 families) (S)
    form timeric structures with the orthogonally packed beta-sheets
  5. 2557730Family d.58.5.0: automated matches [191474] (1 protein)
    not a true family
  6. 2557731Protein automated matches [190753] (21 species)
    not a true protein
  7. 2557811Species Cyanobium sp. [TaxId:180281] [374194] (6 PDB entries)
  8. 2557825Domain d6mmqc_: 6mmq C: [374196]
    Other proteins in same PDB: d6mmqb2
    automated match to d3dfeb_
    complexed with cmp

Details for d6mmqc_

PDB Entry: 6mmq (more details), 2.02 Å

PDB Description: carbon regulatory pii-like protein sbtb from cyanobium sp. 7001 bound to camp
PDB Compounds: (C:) Carbon regulatory PII-like protein SbtB

SCOPe Domain Sequences for d6mmqc_:

Sequence, based on SEQRES records: (download)

>d6mmqc_ d.58.5.0 (C:) automated matches {Cyanobium sp. [TaxId: 180281]}
sqqvwklviiteeillkkvskiikeagasgytvlaaagegsrnvrstgepsvshaysnik
fevltasreladqiqdkvvakyfddyscityistveal

Sequence, based on observed residues (ATOM records): (download)

>d6mmqc_ d.58.5.0 (C:) automated matches {Cyanobium sp. [TaxId: 180281]}
sqqvwklviiteeillkkvskiikeagasgytvlaaagegsshaysnikfevltasrela
dqiqdkvvakyfddyscityistveal

SCOPe Domain Coordinates for d6mmqc_:

Click to download the PDB-style file with coordinates for d6mmqc_.
(The format of our PDB-style files is described here.)

Timeline for d6mmqc_: