Lineage for d1hrja_ (1hrj A:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 716158Fold d.9: IL8-like [54116] (2 superfamilies)
    beta(3)-alpha
  4. 716159Superfamily d.9.1: Interleukin 8-like chemokines [54117] (1 family) (S)
    form dimers with different dimerisation modes
  5. 716160Family d.9.1.1: Interleukin 8-like chemokines [54118] (24 proteins)
  6. 716335Protein RANTES (regulated upon activation, normal T-cell expressed and secreted) [54132] (1 species)
    has different dimerisation mode
  7. 716336Species Human (Homo sapiens) [TaxId:9606] [54133] (9 PDB entries)
  8. 716353Domain d1hrja_: 1hrj A: [37418]

Details for d1hrja_

PDB Entry: 1hrj (more details)

PDB Description: human rantes, nmr, 13 structures
PDB Compounds: (A:) human regulated upon activation normal T-cell expressed and secreted

SCOP Domain Sequences for d1hrja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hrja_ d.9.1.1 (A:) RANTES (regulated upon activation, normal T-cell expressed and secreted) {Human (Homo sapiens) [TaxId: 9606]}
spyssdttpccfayiarplprahikeyfytsgkcsnpavvfvtrknrqvcanpekkwvre
yinslems

SCOP Domain Coordinates for d1hrja_:

Click to download the PDB-style file with coordinates for d1hrja_.
(The format of our PDB-style files is described here.)

Timeline for d1hrja_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1hrjb_