SCOPe 2.06: Domain d1rtob_: 1rto B:

Lineage for d1rtob_ (1rto B:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.9: IL8-like [54116] (2 superfamilies)
   beta(3)-alpha

4. Superfamily d.9.1: Interleukin 8-like chemokines [54117] (2 families)
   form dimers with different dimerisation modes

5. Family d.9.1.1: Interleukin 8-like chemokines [54118] (25 proteins)

6. Protein RANTES (regulated upon activation, normal T-cell expressed and secreted) [54132] (1 species)
   has different dimerisation mode

7. Species Human (Homo sapiens) [TaxId:9606] [54133] (14 PDB entries)
   Uniprot P13501 25-91

8. Domain d1rtob_: 1rto B: [37417]

Details for d1rtob_

PDB Entry: 1rto

PDB Description: proton nmr assignments and solution conformation of rantes, a chemokine of the cc type

PDB Compounds: (B:) rantes

SCOPe Domain Sequences for d1rtob_:

Sequence; same for both SEQRES and ATOM records:

>d1rtob_ d.9.1.1 (B:) RANTES (regulated upon activation, normal T-cell expressed and secreted) {Human (Homo sapiens) [TaxId: 9606]}
spyssdttpccfayiarplprahikeyfytsgkcsnpavvfvtrknrqvcanpekkwvre
yinslems

Timeline for d1rtob_:

• d1rtob_ first appeared (with stable ids) in SCOP 1.55
  
• d1rtob_ appears in SCOPe 2.05
  
• d1rtob_ appears in SCOPe 2.07
  
• d1rtob_ appears in the current release, SCOPe 2.08