Class a: All alpha proteins [46456] (290 folds) |
Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) contains bimetal-ion centre in the middle of the bundle |
Family a.25.1.0: automated matches [191307] (1 protein) not a true family |
Protein automated matches [190036] (60 species) not a true protein |
Species Soybean (Glycine max) [TaxId:3847] [255741] (4 PDB entries) |
Domain d6j4je_: 6j4j E: [374165] automated match to d3a68r_ complexed with mg |
PDB Entry: 6j4j (more details), 2.1 Å
SCOPe Domain Sequences for d6j4je_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6j4je_ a.25.1.0 (E:) automated matches {Soybean (Glycine max) [TaxId: 3847]} nvslarqnyaddsesaineqinveynvsyvyhalfayfdrdnialkglakffkesseeer ehaeqlikyqnirggrvvlhpitsppsefehsekgdalyamelalslekltnekllhvhs vadrnndpqladfieseflyeqvksikkiaeyvaqlrlvgkghgvwhfdqkllhd
Timeline for d6j4je_: