Lineage for d1rtoa_ (1rto A:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 30036Fold d.9: IL8-like [54116] (2 superfamilies)
  4. 30037Superfamily d.9.1: Interleukin 8-like chemokines [54117] (1 family) (S)
  5. 30038Family d.9.1.1: Interleukin 8-like chemokines [54118] (19 proteins)
  6. 30165Protein RANTES (regulated upon activation, normal T-cell expressed and secreted) [54132] (1 species)
  7. 30166Species Human (Homo sapiens) [TaxId:9606] [54133] (5 PDB entries)
  8. 30173Domain d1rtoa_: 1rto A: [37416]

Details for d1rtoa_

PDB Entry: 1rto (more details)

PDB Description: proton nmr assignments and solution conformation of rantes, a chemokine of the cc type

SCOP Domain Sequences for d1rtoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rtoa_ d.9.1.1 (A:) RANTES (regulated upon activation, normal T-cell expressed and secreted) {Human (Homo sapiens)}
spyssdttpccfayiarplprahikeyfytsgkcsnpavvfvtrknrqvcanpekkwvre
yinslems

SCOP Domain Coordinates for d1rtoa_:

Click to download the PDB-style file with coordinates for d1rtoa_.
(The format of our PDB-style files is described here.)

Timeline for d1rtoa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1rtob_