Lineage for d6ij6a1 (6ij6 A:34-290)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2899459Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2899460Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2901917Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. 2901918Protein automated matches [190543] (131 species)
    not a true protein
  7. 2902426Species Ideonella sakaiensis [TaxId:1547922] [343272] (26 PDB entries)
  8. 2902459Domain d6ij6a1: 6ij6 A:34-290 [374151]
    Other proteins in same PDB: d6ij6a2, d6ij6a3
    automated match to d5xfya_
    mutant

Details for d6ij6a1

PDB Entry: 6ij6 (more details), 1.95 Å

PDB Description: crystal structure of petase s121e, d186h, r280a mutant from ideonella sakaiensis
PDB Compounds: (A:) Poly(ethylene terephthalate) hydrolase

SCOPe Domain Sequences for d6ij6a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ij6a1 c.69.1.0 (A:34-290) automated matches {Ideonella sakaiensis [TaxId: 1547922]}
rgpnptaasleasagpftvrsftvsrpsgygagtvyyptnaggtvgaiaivpgytarqss
ikwwgprlashgfvvitidtnstldqpesrssqqmaalrqvaslngtssspiygkvdtar
mgvmgwsmggggslisaannpslkaaapqapwhsstnfssvtvptlifacendsiapvns
salpiydsmsrnakqfleinggshscansgnsnqaligkkgvawmkrfmdndtrystfac
enpnstavsdfrtancs

SCOPe Domain Coordinates for d6ij6a1:

Click to download the PDB-style file with coordinates for d6ij6a1.
(The format of our PDB-style files is described here.)

Timeline for d6ij6a1: