Lineage for d6j4ja_ (6j4j A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2700837Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2700838Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2703895Family a.25.1.0: automated matches [191307] (1 protein)
    not a true family
  6. 2703896Protein automated matches [190036] (60 species)
    not a true protein
  7. 2705060Species Soybean (Glycine max) [TaxId:3847] [255741] (4 PDB entries)
  8. 2705109Domain d6j4ja_: 6j4j A: [374147]
    automated match to d3a68r_
    complexed with mg

Details for d6j4ja_

PDB Entry: 6j4j (more details), 2.1 Å

PDB Description: soybean seed h-2 ferritin
PDB Compounds: (A:) Ferritin

SCOPe Domain Sequences for d6j4ja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6j4ja_ a.25.1.0 (A:) automated matches {Soybean (Glycine max) [TaxId: 3847]}
nvslarqnyaddsesaineqinveynvsyvyhalfayfdrdnialkglakffkesseeer
ehaeqlikyqnirggrvvlhpitsppsefehsekgdalyamelalslekltnekllhvhs
vadrnndpqladfieseflyeqvksikkiaeyvaqlrlvgkghgvwhfdqkllhd

SCOPe Domain Coordinates for d6j4ja_:

Click to download the PDB-style file with coordinates for d6j4ja_.
(The format of our PDB-style files is described here.)

Timeline for d6j4ja_: