SCOP 1.55: Domain d1rtna_: 1rtn A:

Lineage for d1rtna_ (1rtn A:)

1. Root: SCOP 1.55

2. Class d: Alpha and beta proteins (a+b) [53931] (184 folds)

3. Fold d.9: IL8-like [54116] (2 superfamilies)

4. Superfamily d.9.1: Interleukin 8-like chemokines [54117] (1 family)

5. Family d.9.1.1: Interleukin 8-like chemokines [54118] (19 proteins)

6. Protein RANTES (regulated upon activation, normal T-cell expressed and secreted) [54132] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [54133] (5 PDB entries)

8. Domain d1rtna_: 1rtn A: [37414]

Details for d1rtna_

PDB Entry: 1rtn

PDB Description: proton nmr assignments and solution conformation of rantes, a chemokine of the cc type

SCOP Domain Sequences for d1rtna_:

Sequence; same for both SEQRES and ATOM records:

>d1rtna_ d.9.1.1 (A:) RANTES (regulated upon activation, normal T-cell expressed and secreted) {Human (Homo sapiens)}
spyssdttpccfayiarplprahikeyfytsgkcsnpavvfvtrknrqvcanpekkwvre
yinslems

Timeline for d1rtna_:

• d1rtna_ appears in SCOP 1.57
  
• d1rtna_ appears in the current release, SCOPe 2.08