![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.18: E set domains [81296] (27 families) ![]() "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
![]() | Family b.1.18.0: automated matches [191341] (1 protein) not a true family |
![]() | Protein automated matches [190226] (81 species) not a true protein |
![]() | Species Klebsiella pneumoniae [TaxId:573] [359373] (10 PDB entries) |
![]() | Domain d6j34a1: 6j34 A:163-287 [374131] Other proteins in same PDB: d6j34a3, d6j34a4 automated match to d2fhfa2 complexed with act, glc, gol, mg |
PDB Entry: 6j34 (more details), 1.5 Å
SCOPe Domain Sequences for d6j34a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6j34a1 b.1.18.0 (A:163-287) automated matches {Klebsiella pneumoniae [TaxId: 573]} sradafraafgvaladahwvdkttllwpggenkpivrlyyshsskvaadsngefsdkyvk ltpttvsqqvsmrfphlasypafklpddvnvdellqgetvaiaaesdgilssatqvqtag vlddt
Timeline for d6j34a1: