SCOPe 2.06: Domain d1eqtb_: 1eqt B:

Lineage for d1eqtb_ (1eqt B:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.9: IL8-like [54116] (2 superfamilies)
   beta(3)-alpha

4. Superfamily d.9.1: Interleukin 8-like chemokines [54117] (2 families)
   form dimers with different dimerisation modes

5. Family d.9.1.1: Interleukin 8-like chemokines [54118] (25 proteins)

6. Protein RANTES (regulated upon activation, normal T-cell expressed and secreted) [54132] (1 species)
   has different dimerisation mode

7. Species Human (Homo sapiens) [TaxId:9606] [54133] (14 PDB entries)
   Uniprot P13501 25-91

8. Domain d1eqtb_: 1eqt B: [37413]
   complexed with so4

Details for d1eqtb_

PDB Entry: 1eqt, 1.6 Å

PDB Description: met-rantes

PDB Compounds: (B:) T-cell specific rantes protein

SCOPe Domain Sequences for d1eqtb_:

Sequence; same for both SEQRES and ATOM records:

>d1eqtb_ d.9.1.1 (B:) RANTES (regulated upon activation, normal T-cell expressed and secreted) {Human (Homo sapiens) [TaxId: 9606]}
gyssdttpccfayiarpmprahikeyfytsgkcsnpavvfvtrknrqvcanpekkwvrey
inslems

Timeline for d1eqtb_:

• d1eqtb_ first appeared (with stable ids) in SCOP 1.55
  
• d1eqtb_ appears in SCOPe 2.05
  
• d1eqtb_ appears in SCOPe 2.07
  
• d1eqtb_ appears in the current release, SCOPe 2.08