SCOPe 2.08: Domain d6j35b3: 6j35 B:288-402

Lineage for d6j35b3 (6j35 B:288-402)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (27 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.0: automated matches [191341] (1 protein)
   not a true family

6. Protein automated matches [190226] (81 species)
   not a true protein

7. Species Klebsiella pneumoniae [TaxId:573] [359373] (10 PDB entries)

8. Domain d6j35b3: 6j35 B:288-402 [374127]
   Other proteins in same PDB: d6j35a1, d6j35a4, d6j35a5, d6j35b1, d6j35b4, d6j35b5
   automated match to d2fhfa1
   complexed with ca, gol, mg; mutant

Details for d6j35b3

PDB Entry: 6j35, 1.84 Å

PDB Description: crystal structure of ligand-free of pula-g680l mutant from klebsiella pneumoniae

PDB Compounds: (B:) pullulanase

SCOPe Domain Sequences for d6j35b3:

Sequence; same for both SEQRES and ATOM records:

>d6j35b3 b.1.18.0 (B:288-402) automated matches {Klebsiella pneumoniae [TaxId: 573]}
yaaaaealsygaqltdsgvtfrvwaptaqqvelviysadkkviashpmtrdsasgawswq
ggsdlkgafyryamtvyhpqsrkveqyevtdpyahslstnseysqvvdlndsalk

Timeline for d6j35b3:

• d6j35b3 first appeared in SCOPe 2.07