Lineage for d6ij5a1 (6ij5 A:34-290)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2507025Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2507026Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2509433Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. 2509434Protein automated matches [190543] (124 species)
    not a true protein
  7. 2509925Species Ideonella sakaiensis [TaxId:1547922] [343272] (26 PDB entries)
  8. 2509953Domain d6ij5a1: 6ij5 A:34-290 [374122]
    Other proteins in same PDB: d6ij5a2, d6ij5a3
    automated match to d5xfya_
    mutant

Details for d6ij5a1

PDB Entry: 6ij5 (more details), 1.72 Å

PDB Description: crystal structure of petase p181a mutant from ideonella sakaiensis
PDB Compounds: (A:) Poly(ethylene terephthalate) hydrolase

SCOPe Domain Sequences for d6ij5a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ij5a1 c.69.1.0 (A:34-290) automated matches {Ideonella sakaiensis [TaxId: 1547922]}
rgpnptaasleasagpftvrsftvsrpsgygagtvyyptnaggtvgaiaivpgytarqss
ikwwgprlashgfvvitidtnstldqpssrssqqmaalrqvaslngtssspiygkvdtar
mgvmgwsmggggslisaannpslkaaaaqapwdsstnfssvtvptlifacendsiapvns
salpiydsmsrnakqfleinggshscansgnsnqaligkkgvawmkrfmdndtrystfac
enpnstrvsdfrtancs

SCOPe Domain Coordinates for d6ij5a1:

Click to download the PDB-style file with coordinates for d6ij5a1.
(The format of our PDB-style files is described here.)

Timeline for d6ij5a1: