Lineage for d6hwmf1 (6hwm F:2-194)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2852293Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2852294Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2853595Family c.14.1.0: automated matches [191346] (1 protein)
    not a true family
  6. 2853596Protein automated matches [190246] (71 species)
    not a true protein
  7. 2854409Species Thermus thermophilus [TaxId:274] [374087] (2 PDB entries)
  8. 2854422Domain d6hwmf1: 6hwm F:2-194 [374114]
    Other proteins in same PDB: d6hwmb2, d6hwme2, d6hwmf2
    automated match to d5g1sq_
    complexed with bo2, peg

Details for d6hwmf1

PDB Entry: 6hwm (more details), 2.7 Å

PDB Description: structure of thermus thermophilus clpp in complex with bortezomib
PDB Compounds: (F:) ATP-dependent Clp protease proteolytic subunit

SCOPe Domain Sequences for d6hwmf1:

Sequence, based on SEQRES records: (download)

>d6hwmf1 c.14.1.0 (F:2-194) automated matches {Thermus thermophilus [TaxId: 274]}
vipyvieqtargervydiysrllkdriiflgtpidaqvanvvvaqllfldaqnpnqeikl
yinspggevdaglaiydtmqfvrapvstivigmaasmaavilaagekgrryalphakvmi
hqpwggvrgtasdiaiqaqeilkakkllneilakhtgqplekvekdtdrdyylsaqeale
yglidqvvtreea

Sequence, based on observed residues (ATOM records): (download)

>d6hwmf1 c.14.1.0 (F:2-194) automated matches {Thermus thermophilus [TaxId: 274]}
vipyviervydiysrllkdriiflgtpidaqvanvvvaqllfldaqnpnqeiklyinspg
gevdaglaiydtmqfvrapvstivigmaasmaavilaagekgrryalphakvmihqpwgg
vrgtasdiaiqaqeilkakkllneilakhtgqplekvekdtdrdyylsaqealeyglidq
vvtreea

SCOPe Domain Coordinates for d6hwmf1:

Click to download the PDB-style file with coordinates for d6hwmf1.
(The format of our PDB-style files is described here.)

Timeline for d6hwmf1: