Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.14: ClpP/crotonase [52095] (1 superfamily) core: 4 turns of (beta-beta-alpha)n superhelix |
Superfamily c.14.1: ClpP/crotonase [52096] (5 families) |
Family c.14.1.0: automated matches [191346] (1 protein) not a true family |
Protein automated matches [190246] (71 species) not a true protein |
Species Thermus thermophilus [TaxId:274] [374087] (2 PDB entries) |
Domain d6hwmf1: 6hwm F:2-194 [374114] Other proteins in same PDB: d6hwmb2, d6hwme2, d6hwmf2 automated match to d5g1sq_ complexed with bo2, peg |
PDB Entry: 6hwm (more details), 2.7 Å
SCOPe Domain Sequences for d6hwmf1:
Sequence, based on SEQRES records: (download)
>d6hwmf1 c.14.1.0 (F:2-194) automated matches {Thermus thermophilus [TaxId: 274]} vipyvieqtargervydiysrllkdriiflgtpidaqvanvvvaqllfldaqnpnqeikl yinspggevdaglaiydtmqfvrapvstivigmaasmaavilaagekgrryalphakvmi hqpwggvrgtasdiaiqaqeilkakkllneilakhtgqplekvekdtdrdyylsaqeale yglidqvvtreea
>d6hwmf1 c.14.1.0 (F:2-194) automated matches {Thermus thermophilus [TaxId: 274]} vipyviervydiysrllkdriiflgtpidaqvanvvvaqllfldaqnpnqeiklyinspg gevdaglaiydtmqfvrapvstivigmaasmaavilaagekgrryalphakvmihqpwgg vrgtasdiaiqaqeilkakkllneilakhtgqplekvekdtdrdyylsaqealeyglidq vvtreea
Timeline for d6hwmf1: