![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) ![]() |
![]() | Family d.15.4.1: 2Fe-2S ferredoxin-related [54293] (4 proteins) |
![]() | Protein automated matches [190231] (14 species) not a true protein |
![]() | Species Thermosynechococcus elongatus [TaxId:197221] [374112] (1 PDB entry) |
![]() | Domain d6iria_: 6iri A: [374113] automated match to d1rfkb_ complexed with fes, so4 |
PDB Entry: 6iri (more details), 1.38 Å
SCOPe Domain Sequences for d6iria_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6iria_ d.15.4.1 (A:) automated matches {Thermosynechococcus elongatus [TaxId: 197221]} tkrdhnkvynvtlvneerglnktirvhadeyildaaeaqgiplpyscragacvncagrii kgtvdqsdhsflkpkeldagfvllcaayptsdcvistheednllnla
Timeline for d6iria_: