| Class d: Alpha and beta proteins (a+b) [53931] (184 folds) |
| Fold d.9: IL8-like [54116] (2 superfamilies) |
Superfamily d.9.1: Interleukin 8-like chemokines [54117] (1 family) ![]() |
| Family d.9.1.1: Interleukin 8-like chemokines [54118] (19 proteins) |
| Protein RANTES (regulated upon activation, normal T-cell expressed and secreted) [54132] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [54133] (5 PDB entries) |
| Domain d1b3ab_: 1b3a B: [37411] |
PDB Entry: 1b3a (more details), 1.6 Å
SCOP Domain Sequences for d1b3ab_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1b3ab_ d.9.1.1 (B:) RANTES (regulated upon activation, normal T-cell expressed and secreted) {Human (Homo sapiens)}
pyssdttpccfayiarplprahikeyfytsgkcsnpavvfvtrknrqvcanpekkwvrey
inslems
Timeline for d1b3ab_: