![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest |
![]() | Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) ![]() |
![]() | Family c.66.1.1: COMT-like [53336] (4 proteins) |
![]() | Protein Catechol O-methyltransferase, COMT [53337] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [267759] (12 PDB entries) |
![]() | Domain d6i3da_: 6i3d A: [374106] Other proteins in same PDB: d6i3db2 automated match to d4xuca_ complexed with dnc, mg, sfg |
PDB Entry: 6i3d (more details), 1.45 Å
SCOPe Domain Sequences for d6i3da_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6i3da_ c.66.1.1 (A:) Catechol O-methyltransferase, COMT {Human (Homo sapiens) [TaxId: 9606]} gdtkeqrilnhvlqhaepgnaqsvleaidtyceqkewamnvgdkkgkivdaviqehqpsv llelgaycgysavrmarllspgarlitieinpdcaaitqrmvdfagvkdkvtlvvgasqd iipqlkkkydvdtldmvfldhwkdrylpdtllleecgllrkgtvlladnvicpgapdfla hvrgsscfecthyqsfleyrevvdglekaiykgp
Timeline for d6i3da_: