Lineage for d6i3da_ (6i3d A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2892669Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2892670Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) (S)
  5. 2892671Family c.66.1.1: COMT-like [53336] (4 proteins)
  6. 2892682Protein Catechol O-methyltransferase, COMT [53337] (2 species)
  7. 2892683Species Human (Homo sapiens) [TaxId:9606] [267759] (12 PDB entries)
  8. 2892687Domain d6i3da_: 6i3d A: [374106]
    Other proteins in same PDB: d6i3db2
    automated match to d4xuca_
    complexed with dnc, mg, sfg

Details for d6i3da_

PDB Entry: 6i3d (more details), 1.45 Å

PDB Description: crystal structure of human soluble catechol o-methyltransferase in complex with 3,5-dinitrocatechol and sinefungin
PDB Compounds: (A:) Catechol O-methyltransferase

SCOPe Domain Sequences for d6i3da_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6i3da_ c.66.1.1 (A:) Catechol O-methyltransferase, COMT {Human (Homo sapiens) [TaxId: 9606]}
gdtkeqrilnhvlqhaepgnaqsvleaidtyceqkewamnvgdkkgkivdaviqehqpsv
llelgaycgysavrmarllspgarlitieinpdcaaitqrmvdfagvkdkvtlvvgasqd
iipqlkkkydvdtldmvfldhwkdrylpdtllleecgllrkgtvlladnvicpgapdfla
hvrgsscfecthyqsfleyrevvdglekaiykgp

SCOPe Domain Coordinates for d6i3da_:

Click to download the PDB-style file with coordinates for d6i3da_.
(The format of our PDB-style files is described here.)

Timeline for d6i3da_: