SCOP 1.55: Domain d1b3aa_: 1b3a A:

Lineage for d1b3aa_ (1b3a A:)

1. Root: SCOP 1.55

2. Class d: Alpha and beta proteins (a+b) [53931] (184 folds)

3. Fold d.9: IL8-like [54116] (2 superfamilies)

4. Superfamily d.9.1: Interleukin 8-like chemokines [54117] (1 family)

5. Family d.9.1.1: Interleukin 8-like chemokines [54118] (19 proteins)

6. Protein RANTES (regulated upon activation, normal T-cell expressed and secreted) [54132] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [54133] (5 PDB entries)

8. Domain d1b3aa_: 1b3a A: [37410]

Details for d1b3aa_

PDB Entry: 1b3a, 1.6 Å

PDB Description: total chemical synthesis and high-resolution crystal structure of the potent anti-hiv protein aop-rantes

SCOP Domain Sequences for d1b3aa_:

Sequence; same for both SEQRES and ATOM records:

>d1b3aa_ d.9.1.1 (A:) RANTES (regulated upon activation, normal T-cell expressed and secreted) {Human (Homo sapiens)}
pyssdttpccfayiarplprahikeyfytsgkcsnpavvfvtrknrqvcanpekkwvrey
inslems

Timeline for d1b3aa_:

• d1b3aa_ appears in SCOP 1.57
  
• d1b3aa_ appears in the current release, SCOPe 2.08