Lineage for d6h63b3 (6h63 B:210-574)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2525681Fold c.96: Fe-only hydrogenase [53919] (1 superfamily)
    consist of two intertwined domains; contains partial duplication
  4. 2525682Superfamily c.96.1: Fe-only hydrogenase [53920] (1 family) (S)
    automatically mapped to Pfam PF02906
  5. 2525683Family c.96.1.1: Fe-only hydrogenase [53921] (3 proteins)
  6. 2525697Protein automated matches [279207] (1 species)
    not a true protein
  7. 2525698Species Clostridium pasteurianum [TaxId:1501] [279208] (17 PDB entries)
  8. 2525722Domain d6h63b3: 6h63 B:210-574 [374097]
    Other proteins in same PDB: d6h63a1, d6h63a2, d6h63a4, d6h63b1, d6h63b2, d6h63b4
    automated match to d3c8ya1
    complexed with fes, fu8, mg, sf4

Details for d6h63b3

PDB Entry: 6h63 (more details), 2.08 Å

PDB Description: semisynthetic [fefe]-hydrogenase cpi with ethanedithiolate [2fe] cofactor
PDB Compounds: (B:) Iron hydrogenase 1

SCOPe Domain Sequences for d6h63b3:

Sequence; same for both SEQRES and ATOM records: (download)

>d6h63b3 c.96.1.1 (B:210-574) automated matches {Clostridium pasteurianum [TaxId: 1501]}
hmdrvknalnapekhvivamapsvrasigelfnmgfgvdvtgkiytalrqlgfdkifdin
fgadmtimeeatelvqrienngpfpmftsccpgwvrqaenyypellnnlssakspqqifg
tasktyypsisgldpknvftvtvmpctskkfeadrpqmekdglrdidavittrelakmik
dakipfakledseadpamgeysgagaifgatggvmeaalrsakdfaenaeledieykqvr
glngikeaeveinnnkynvavingasnlfkfmksgminekqyhfievmachggcvngggq
phvnpkdlekvdikkvrasvlynqdehlskrkshentalvkmyqnyfgkpgegraheilh
fkykk

SCOPe Domain Coordinates for d6h63b3:

Click to download the PDB-style file with coordinates for d6h63b3.
(The format of our PDB-style files is described here.)

Timeline for d6h63b3: