![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (7 families) ![]() |
![]() | Family d.58.1.0: automated matches [229598] (1 protein) not a true family |
![]() | Protein automated matches [229599] (4 species) not a true protein |
![]() | Species Clostridium pasteurianum [TaxId:1501] [279205] (17 PDB entries) |
![]() | Domain d6h63b2: 6h63 B:127-209 [374094] Other proteins in same PDB: d6h63a1, d6h63a3, d6h63a4, d6h63b1, d6h63b3, d6h63b4 automated match to d3c8ya3 complexed with fes, fu8, mg, sf4 |
PDB Entry: 6h63 (more details), 2.08 Å
SCOPe Domain Sequences for d6h63b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6h63b2 d.58.1.0 (B:127-209) automated matches {Clostridium pasteurianum [TaxId: 1501]} kdkteyvdersksltvdrtkcllcgrcvnacgkntetyamkflnkngktiigaedekcfd dtncllcgqciiacpvaalseks
Timeline for d6h63b2:
![]() Domains from other chains: (mouse over for more information) d6h63a1, d6h63a2, d6h63a3, d6h63a4 |