Lineage for d6h63b1 (6h63 B:2-126)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2538334Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2540890Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) (S)
  5. 2541309Family d.15.4.0: automated matches [191632] (1 protein)
    not a true family
  6. 2541310Protein automated matches [191164] (24 species)
    not a true protein
  7. 2541314Species Clostridium pasteurianum [TaxId:1501] [279203] (17 PDB entries)
  8. 2541338Domain d6h63b1: 6h63 B:2-126 [374093]
    Other proteins in same PDB: d6h63a2, d6h63a3, d6h63a4, d6h63b2, d6h63b3, d6h63b4
    automated match to d3c8ya2
    complexed with fes, fu8, mg, sf4

Details for d6h63b1

PDB Entry: 6h63 (more details), 2.08 Å

PDB Description: semisynthetic [fefe]-hydrogenase cpi with ethanedithiolate [2fe] cofactor
PDB Compounds: (B:) Iron hydrogenase 1

SCOPe Domain Sequences for d6h63b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6h63b1 d.15.4.0 (B:2-126) automated matches {Clostridium pasteurianum [TaxId: 1501]}
ktiiingvqfntdedttilkfardnnidisalcflnncnndinkceictvevegtglvta
cdtliedgmiintnsdavnekiksrisqlldihefkcgpcnrrenceflklvikykaras
kpflp

SCOPe Domain Coordinates for d6h63b1:

Click to download the PDB-style file with coordinates for d6h63b1.
(The format of our PDB-style files is described here.)

Timeline for d6h63b1: