Lineage for d1hfga_ (1hfg A:)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 188772Fold d.9: IL8-like [54116] (2 superfamilies)
  4. 188773Superfamily d.9.1: Interleukin 8-like chemokines [54117] (1 family) (S)
  5. 188774Family d.9.1.1: Interleukin 8-like chemokines [54118] (22 proteins)
  6. 188834Protein Macrophage inflammatory protein, MIP [54128] (5 species)
  7. 188849Species Kaposi's sarcoma herpes virus, VMIP-II [54131] (4 PDB entries)
  8. 188854Domain d1hfga_: 1hfg A: [37409]

Details for d1hfga_

PDB Entry: 1hfg (more details)

PDB Description: nmr solution structure of vmip-ii 1-71 from kaposi's sarcoma-associated herpesvirus (minimized average structure).

SCOP Domain Sequences for d1hfga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hfga_ d.9.1.1 (A:) Macrophage inflammatory protein, MIP {Kaposi's sarcoma herpes virus, VMIP-II}
lgaswhrpdkcclgyqkrplpqvllsswyptsqlcskpgvifltkrgrqvcadkskdwvk
klmqqlpvtar

SCOP Domain Coordinates for d1hfga_:

Click to download the PDB-style file with coordinates for d1hfga_.
(The format of our PDB-style files is described here.)

Timeline for d1hfga_: