Lineage for d6hwne_ (6hwn E:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2852293Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2852294Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2853595Family c.14.1.0: automated matches [191346] (1 protein)
    not a true family
  6. 2853596Protein automated matches [190246] (71 species)
    not a true protein
  7. 2854409Species Thermus thermophilus [TaxId:274] [374087] (2 PDB entries)
  8. 2854414Domain d6hwne_: 6hwn E: [374088]
    Other proteins in same PDB: d6hwna2, d6hwnd2
    automated match to d5g1sq_
    complexed with peg

Details for d6hwne_

PDB Entry: 6hwn (more details), 1.95 Å

PDB Description: structure of thermus thermophilus clpp in complex with a tripeptide.
PDB Compounds: (E:) ATP-dependent Clp protease proteolytic subunit

SCOPe Domain Sequences for d6hwne_:

Sequence, based on SEQRES records: (download)

>d6hwne_ c.14.1.0 (E:) automated matches {Thermus thermophilus [TaxId: 274]}
ipyvieqtargervydiysrllkdriiflgtpidaqvanvvvaqllfldaqnpnqeikly
inspggevdaglaiydtmqfvrapvstivigmaasmaavilaagekgrryalphakvmih
qpwggvrgtasdiaiqaqeilkakkllneilakhtgqplekvekdtdrdyylsaqealey
glidqvvtreea

Sequence, based on observed residues (ATOM records): (download)

>d6hwne_ c.14.1.0 (E:) automated matches {Thermus thermophilus [TaxId: 274]}
ipyviervydiysrllkdriiflgtpidaqvanvvvaqllfldaqnpnqeiklyinspgg
evdaglaiydtmqfvrapvstivigmaasmaavilaagekgrryalphakvmihqpwggv
rgtasdiaiqaqeilkakkllneilakhtgqplekvekdtdrdyylsaqealeyglidqv
vtreea

SCOPe Domain Coordinates for d6hwne_:

Click to download the PDB-style file with coordinates for d6hwne_.
(The format of our PDB-style files is described here.)

Timeline for d6hwne_: