Lineage for d1hfna_ (1hfn A:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1016266Fold d.9: IL8-like [54116] (2 superfamilies)
    beta(3)-alpha
  4. 1016267Superfamily d.9.1: Interleukin 8-like chemokines [54117] (2 families) (S)
    form dimers with different dimerisation modes
  5. 1016268Family d.9.1.1: Interleukin 8-like chemokines [54118] (25 proteins)
  6. 1016336Protein Macrophage inflammatory protein, MIP [54128] (5 species)
    has different dimerisation mode
  7. 1016372Species Kaposi's sarcoma-associated herpesvirus, VMIP-II [TaxId:37296] [54131] (7 PDB entries)
    anti-HIV chemokine
  8. 1016381Domain d1hfna_: 1hfn A: [37408]

Details for d1hfna_

PDB Entry: 1hfn (more details)

PDB Description: nmr solution structures of vmip-ii 1-71 from kaposi's sarcoma-associated herpesvirus.
PDB Compounds: (A:) Viral macrophage inflammatory protein-II

SCOPe Domain Sequences for d1hfna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hfna_ d.9.1.1 (A:) Macrophage inflammatory protein, MIP {Kaposi's sarcoma-associated herpesvirus, VMIP-II [TaxId: 37296]}
lgaswhrpdkcclgyqkrplpqvllsswyptsqlcskpgvifltkrgrqvcadkskdwvk
klmqqlpvtar

SCOPe Domain Coordinates for d1hfna_:

Click to download the PDB-style file with coordinates for d1hfna_.
(The format of our PDB-style files is described here.)

Timeline for d1hfna_: